SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879767|ref|YP_003848331.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879767|ref|YP_003848331.1|
Domain Number 1 Region: 656-828
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.71e-44
Family Histidine kinase 0.00087
Further Details:      
 
Domain Number 2 Region: 990-1116
Classification Level Classification E-value
Superfamily CheY-like 2.85e-36
Family CheY-related 0.0075
Further Details:      
 
Domain Number 3 Region: 848-978
Classification Level Classification E-value
Superfamily CheY-like 2.56e-32
Family CheY-related 0.017
Further Details:      
 
Domain Number 4 Region: 218-318
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.11e-28
Family Flavin-binding PAS domain 0.0087
Further Details:      
 
Domain Number 5 Region: 588-668
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-23
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 6 Region: 317-439
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.74e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.085
Further Details:      
 
Domain Number 7 Region: 470-585
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.36e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.042
Further Details:      
 
Domain Number 8 Region: 1091-1216
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 3.53e-17
Family Sensor-like histidine kinase YojN, C-terminal domain 0.058
Further Details:      
 
Domain Number 9 Region: 62-182
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.36e-17
Family Heme-binding PAS domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302879767|ref|YP_003848331.1|
Sequence length 1233
Comment multi-sensor hybrid histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MHRLLERQLRRQLGKDFQADAALTSFLDIVDSYYHEVDKEQRLLQNSLSMNTAELNAVNE
RMRIQNTEMTRTLLNTLSDGVYATDLEGCLTFMNAAAEKKLGWSEQELIGLPVQEHVQCL
LPDGSAQQPEDCPHLKSIRDGVSLQANAIFSGRNGELIPVEFRSSPILQNGKVSGALVSF
QDTSLHIEAANKLRLANDKLSSALRELEFQQLALDEHAIVSIADKRGCIVYVNRKFSEIS
QYTTDQLTGQDHRILNSGYHSRAFFTDMWRTIEGGQVWHGEVRNRRRDGTFYWVESTIVP
FMDEEGRPERYISVRTDITARKMLEEQLSEQRAFYERISETMGEGLYVQDSEGRCTYMNS
EAEHMLGWTREELLGRPVHDTIHCVTAEGDVLPAEQCPILLAVRKNGDWQGDDQVFVRKD
GTTFPVEGTSRAIIRDGVSYGSVVAFSDISERKNSERIVRLAQERLNLALEGSGLALWDW
DVAHDQVYLSDRWSLILGDELQEVVITSTQLFSLVHADERAKIESDLVAVLKGQNEFYSV
EFRVQRRDGVWIWIHTHGKVVDRDSNGRVTRMTGTNADITARREAEAALRQAKEAAEAAS
RAKGDFLANMSHEIRTPMNGIIGMTELALDTELNSEQREYLGLVQSSADALLTILNDILD
FSKIESGKLDIENIEFSLEHMLRETMKSLAVRAHQKQLELLLHVAPDVPDRLLGDPGRLR
QVIVNLVGNAIKFTASGEIEVDVQCLKGAPEGQMRMQFSVRDTGIGIARDKFQTIFESFS
QADTSTTRRYGGTGLGLTISAQLVSLMGGSIALESEVGQGSNFYFTLDMPMLSVSPLAEY
QQTGRIAGMTVLIADDNATNRRLLQEMLTNWKMHPVVTSNGQEALDELARATASGHPYGL
ALLDLQMPDMDGFELAEHIREHPEYLVKTLMMLTSEGQRGHASRCRELGVAAYLMKPIAQ
SELFDAIMTALGVSEQPLTTRHSLKEMRRRLNLLLAEDNAVNQTLATRLLTKLGHTVTVA
NNGIEAVQLWQNGSFDAILMDVDMPEMNGYDATRCIREQEQQLGVGAHIRIVAMTAHAMQ
GAREECLLNGMDGYLTKPIDTEALWQELDSLVQRAEVDAVVPAAVLAVADFEQARQIMDD
SRELFDEISSLFLLDAPSHMQQIKEGALRGDAAAVRHSAHTIKGMAGIYAAESTMHFSEL
VEKTAGEPECAAAVAQMEVALTELIAAIKAYQW
Download sequence
Identical sequences D9SCI6
gi|302879767|ref|YP_003848331.1| WP_013294487.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]