SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879885|ref|YP_003848449.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879885|ref|YP_003848449.1|
Domain Number 1 Region: 128-440
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.3e-68
Family hypothetical RNA methyltransferase 0.00000444
Further Details:      
 
Domain Number 2 Region: 53-121
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000572
Family Hypothetical RNA methyltransferase domain (HRMD) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879885|ref|YP_003848449.1|
Sequence length 445
Comment PUA domain containing protein [Gallionella capsiferriformans ES-2]
Sequence
MSKPTNTRSASTPHRTSQGNRDFRKRTQREARPAAPPQSRSVPVAGDATAQAAIILKEGR
EKSLLRRHPWVFSGAIERIDGTPVSGDTLQVVDAAGKFVAQAAYNAGSQITARVWSWNPE
EAIDTAFFRRKIATAIAGRAGLNLAKDSSGMRLIHAESDGLPGLIVDQYGDVLVMQIGSA
GIEHWRAQIADILQELCNPACIYERSDSDSRTLEGLELRCGVLRGTLPDTVEVIEHGLRF
RVDVADGQKTGFYLDQRDNRKLTETLAEGRDVLNCFCYTGGFSLYALRGGAKSVLSMDAS
GEALHIATDNLTRNNLDESRAEWQEADVFVALRKLRDQGKTFDMIILDPPKFAPTAAFAE
KAARGYKDINLLGFKLLRPGGLLFTYSCSGGISEELFQKIIAGAALDAGVDAQIVRHLHA
SGDHPVLLSFPEGAYLKGLLLRVAD
Download sequence
Identical sequences D9SD87
WP_013294604.1.12990 gi|302879885|ref|YP_003848449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]