SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879924|ref|YP_003848488.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879924|ref|YP_003848488.1|
Domain Number 1 Region: 187-294
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.96e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.084
Further Details:      
 
Domain Number 2 Region: 522-645
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-18
Family Histidine kinase 0.032
Further Details:      
 
Domain Number 3 Region: 289-420
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000387
Family Flavin-binding PAS domain 0.072
Further Details:      
 
Domain Number 4 Region: 47-157
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000209
Family Flavin-binding PAS domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302879924|ref|YP_003848488.1|
Sequence length 647
Comment PAS/PAC sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MSIQTILENRVCALELETAQSCSESEQLRSLFLRDGRVDGASLRLKTLLSILDSMPAMIG
YWDRNLHNRFSNRAYSTWFGVSPVKLLGKHIRELLGEQIYQLNLPYIEAVLQGVPQKFER
TIPVPDGTGVRYSLAEYIPDIVDDNVVGFFVQVSDITAIKLAEKGLRENAHSLQQSEARY
RSIVQEQTELVSRLRVDGSYIFANETFLKFFGKSSVELLNSGWHPIVYQDDLLRVNAEIS
KLSLENPVVMIENRVYSSDGQVHWMQFNNRGLFDADGQLVEIQSVGRDISDRKQIEMNLR
ESEARFQVMTANVPGMVFQCTQREAGFNFTYISNGAEWLLGVSATAIEHDANEFLARILP
EHVDAFNHSLTHSHREMTLWNWEGRVLSADNGIKWINLRATPRMLAGGGCIWDGVAVNVT
ESKGIEEKLLHSQQMLRELSAHLENIREDEHRHIAREIHDELGQALTALRMDVSLVRLNF
GEANPQLLTHLQSMSQRVQRTVDIVRHITSSLRPGALDMGIVAALEWLAEEFTGYTQIQC
ELALNDGNIALDEFSATAVFRIVQESLTNIARHAQATQVEVIVTRSEDELCFEVCDNGTG
FDPGAIENCKSFGLIGIRERVAMLSGHFEIESRQGAGTCLRVHIPVA
Download sequence
Identical sequences D9SDC6
gi|302879924|ref|YP_003848488.1| WP_013294627.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]