SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879926|ref|YP_003848490.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879926|ref|YP_003848490.1|
Domain Number 1 Region: 606-887
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 7.19e-73
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000000806
Further Details:      
 
Domain Number 2 Region: 20-114
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.55e-25
Family Flavin-binding PAS domain 0.014
Further Details:      
 
Domain Number 3 Region: 363-408
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000275
Family HAMP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302879926|ref|YP_003848490.1|
Sequence length 925
Comment methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor [Gallionella capsiferriformans ES-2]
Sequence
MRTNLPVTDNEYLLQDGTMLVSSTDLNGVITFCNRNFIEASGYSEKELLGQPHNLVRHPH
MPAEAFEDMWENLKNGKSWSSIVKNRRKNGDFYWVMANVTPVHNDGVATGYMSVRSKPSR
EQVATAEAGYRNLLAGDAKSLRIQAGKIVRHTLLSALKIQLKKLSIGQRLALGFGMMMLL
LAIIGATSYRGITEFGQQWQNYQQTVNQKRTYLEQARIELGDGIHHFKNYLIRGGEYKEK
FYADMSAMDKTITAFSQVPGITSDEIDALTNLREGKTRYLAAIDEMARLKALGKSIAEID
SSIKGADKAMGSALEKLSQHIKDDTGQRTENVTSGITSATRLLLILLGVSLAISGLLNLW
TARSILLPVRKATRAAQAVSRGEYSHEIDAEGRTDELGQMLEEFKVMQIRTGYSVKHAEE
NTAEALRIKSALDSVSSCVTVSDERNEVIYFNEAMRKQINLMQPQMQRLFPDFNTEDIIG
KRVGNFFESDELRTAYAAPLDAPKRFEVPMAGRDMRLEPCPIYNSQRTYLGRVTQWIDRT
NEVAVEREIASIVASAAAGDFAPRVELTGKEGFFLKLAEDMNLFLSASESGLNEVVSVLG
ALAKGDLTQTMNGNHQGTFRQLQDDANTTSEQLTDIISQIKIAAETINMASKEIASGNTD
LSQRTEQQAASLEETASSMEQITATVKHNTDNAHQANKIAHGASEIARRGGEAVGRVVHT
MESISESSKKIVDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAAEVRNLAQRS
AVAANEIKKLITDSVAKVSEGTQLVGVAGQTMGEILSAVNRVNDIMSEISAASDEQSTGI
EQVNRAITQMDDVTQQNAALVEQAAAAAESMEEQAQELNRLMLTFRLNSGAPAVHYPARQ
PEKRPVQKPKALPKASNDKETWEEF
Download sequence
Identical sequences D9SDC8
gi|302879926|ref|YP_003848490.1| WP_013294629.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]