SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302880016|ref|YP_003848580.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302880016|ref|YP_003848580.1|
Domain Number 1 Region: 281-548
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.95e-57
Family Tyrosine-dependent oxidoreductases 0.0028
Further Details:      
 
Domain Number 2 Region: 111-328
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.46e-17
Family Spermidine synthase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302880016|ref|YP_003848580.1|
Sequence length 614
Comment polysaccharide biosynthesis protein CapD [Gallionella capsiferriformans ES-2]
Sequence
MLRKSNVRTVLAILHDIAAAVLAWTLAYLLRFNFELPSQYGAEMRQTLLWIVPLQVAIFW
KFGLYRGIWRYASLNDLRRIVLAVLLAAAAIPFMLWMLRSQLVVPRSVLVLNPLLLILFM
GGSRILYRMWKETRFQGRMKLSSEPVLVLGAGDAAVALSKDLAKNETWQLLGFLDDDDNK
QNCMLNGVKVLGKLDELAHWINHFGVERVIIAMPSSSHQQRQRAIKLCTAAGVQALTVPS
FDDLMSGKVAVSQLRAIELDDLLGRDPVVLDTAGLQGLISGKTVMVTGAGGSIGSELCRQ
IARFSPAKLVLFEQSEFALYTLEQELHQAFPALCFVCLVGDVRDAARVDEVLQLHNPAVL
FHAAAYKHVPMMETHNAWQAIRNNVLGTWTVARAAQRHNVAKFVMISTDKAVNPTNVMGA
SKRLAELVCQALQPLASEVSGCTRFVIVRFGNVLGSTGSVIPKFRAQIAQGGPITVTHPE
ITRYFMSIPEAAQLVLQAGLMGQGGEIFVLDMGEPVKIVDLAKELIRLSGFTEDDIKIEF
SGLRPGEKLYEELLADNEHTLPTPHPKLRIAQAREADAAWLEQLLIWTDASTRPDAEVKT
ALQGWVPEYQPQHI
Download sequence
Identical sequences D9SDZ4
WP_013294718.1.12990 gi|302880016|ref|YP_003848580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]