SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302880100|ref|YP_003848664.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302880100|ref|YP_003848664.1|
Domain Number 1 Region: 146-217,254-368
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.26e-37
Family Precorrin-6Y methyltransferase (CbiT) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302880100|ref|YP_003848664.1|
Sequence length 381
Comment rRNA (guanine-N(2)-)-methyltransferase [Gallionella capsiferriformans ES-2]
Sequence
MTDFFAPCPRGLETVLFNDLVEMGGQNVRATEGGVHFSGDWALCYRVNLENRVASRVLWR
VKEGWYRTEQDIYKAVFDLQWQRWFNVTHTIRVNTTAIRCALKSLEFITLLVKDAVCDRF
RAHCDERPSVDTLTPDVRIHVFLEDEKLMLYLDTSGDPLFKRGVRQNTNIAPIRENLAAG
ILRLSGWTPGTPLLDPMCGSGTFLIEAVQMSLNIQPGIARSFAFEKLLNFDKPVWQAMKQ
AAIAAQVPPKPLEIYGSDMYGDAMKTAWRNLSDAGLSDCVELNQANILEISAPAEHGIMV
ANLPYGERMGELDELAELYPKLGDTLKRKFGGWTAYLFTADKAILKLMRLSPSKRTPLFN
GAIECRLLEYKIVSGSNRPAK
Download sequence
Identical sequences D9SE78
WP_013294802.1.12990 gi|302880100|ref|YP_003848664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]