SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302877361|ref|YP_003845925.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877361|ref|YP_003845925.1|
Domain Number 1 Region: 1306-1555
Classification Level Classification E-value
Superfamily EAL domain-like 1.31e-74
Family EAL domain 0.0062
Further Details:      
 
Domain Number 2 Region: 62-246
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.98e-55
Family Methylesterase CheB, C-terminal domain 0.0000862
Further Details:      
 
Domain Number 3 Region: 1135-1292
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.65e-51
Family GGDEF domain 0.0001
Further Details:      
 
Domain Number 4 Region: 328-520
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.85e-38
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00036
Further Details:      
 
Domain Number 5 Region: 1011-1117
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-27
Family Flavin-binding PAS domain 0.023
Further Details:      
 
Domain Number 6 Region: 868-986
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.51e-17
Family Heme-binding PAS domain 0.049
Further Details:      
 
Domain Number 7 Region: 261-329
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000589
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0074
Further Details:      
 
Weak hits

Sequence:  gi|302877361|ref|YP_003845925.1|
Domain Number - Region: 690-754
Classification Level Classification E-value
Superfamily Tropomyosin 0.00199
Family Tropomyosin 0.0061
Further Details:      
 
Domain Number - Region: 780-879
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00349
Family Heme-binding PAS domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302877361|ref|YP_003845925.1|
Sequence length 1561
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MTKAQTGVVLPVIRRIKEKAELPIDSSAEERNFIAEMASKKPRKPRKPAVKAEIPVAPVE
ERNFIVGIGASAGGLEALSDLIGSLPDDLGVPYIVVQHLSPTHRSMMVPLLARETSMLVK
DAEDGEIPLANVVYVTPANWNIILKDGVMRLLVPGKTVMPKPSATALFNSMAEEKGEDAI
GVILSGTGSDGAAGIAAIKAAGGFTFAQDPEAAKYSGMPQAAISTGCVEWVLTCRGIAEE
ITAIARAHGLINRATKQENAPATMKGLLQMVYKHSKIDFSGYKEATLSRRVERRMAANRL
NNLAAYFDYCSKNPDELNKLSKDILISVTAFFRDRNSFEGLRKILADIVALKQTGDEIRI
WVPACATGEEAYSIGILLSDILGSKLSDYRIQIFATDIDMDAMAVARKGIYNESSLTEVS
ADTTARYFSKHADTYEIARPIRDMVVFARQDLVLDPPFLRLDLVSCRNLLIYFQPLLQTR
VLSIFHFALRPAAYLFLGKSESIVHQDNLFSPVSKEARIFVRVASKDQMIPIPLYTSQEA
GVKQPITIAERTSRKPESRLQKALSEIYAPPSVLINREMDIVEVHGDMQSYLHFPAGKLE
MNLAQLLRREWRTEVQTLVHHAELKRTNAMGRIRPVKHSAGLSVQIEVHPVASRDDQKLF
LISFISLTAEPGEVHPEDRMPVNSSELEDELIATREHLQTVIEELETSNEELQALNEEMQ
AANEELQSSNEELEASNEELQSTNEELTTVNEELIVKGGELSLVNTELENLQNSTGFSLI
LLDQELRLQRYNKEAASLFGFSVHTLGKSIPGLAVPVIDVLETAKLAMSDGIKRQKQMSF
GGKHYNVLCFPYTSQDQTLGGVIVTFIDQTELMEAQQEILSSKDRLTGVMQNSPMLISIK
DPAGRYQFVNNAFESIFALTPGSAIGNTDTQIFPESIAVLFEKLHFDVLHKKNRVEAEER
ILIGDQQHWLSFICYPINDEKGSVGAVCSQVIIVTARRELDEQKKLTTKFFDAASEGLMI
TDSHQNIIKVNHAFVRMTGYDEADVIGKNPSLLSSGKHEDTFYSAMWQEINQHGWWQGEL
WNRRKDGTHYLEWLTIHTLRDEHGHLTNYIAIFSDITLIKAAQRRLEYMVAHDELTSLPN
RNELRGRMAQTFARAQRHGGTFALMFIDLDNFKNVNDNLGHDYGDVLLQQVAERLGLCVR
TEDTVARIGGDEFNVLLDDVSETQIANTAQRILDHVSKPYLIKEQQVFVSASIGIAVYPK
DAEDIETLTKNADSAMYQAKDKGKDSYQFFTSDLKEKINHRIEIGNALHKAIDANELKLV
YQPEFNLQTGELIGAEALLRWHSSLFGIVGPDEFIPIAEESDLILELGEWVIEQAARQLN
LWRKADTPLPGTLFVNVAPRQLARQPLLAIITRQLQKHRLPSGSLGIEITERTLVNSSED
ISVKLHKIELEEIPIAIDDFGTGYSSLSYLKSFPISFLKIPNQFIDGITTDESDKGIATA
IHGVSVALKLQTIAEGIETEDQLIMLREMGCQSGQGYLLGRPVDPNQFVELFISNRKSHV
R
Download sequence
Identical sequences D9SIA4
WP_013292104.1.12990 gi|302877361|ref|YP_003845925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]