SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302878855|ref|YP_003847419.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302878855|ref|YP_003847419.1|
Domain Number 1 Region: 670-917
Classification Level Classification E-value
Superfamily EAL domain-like 2.75e-88
Family EAL domain 0.0025
Further Details:      
 
Domain Number 2 Region: 493-656
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.26e-48
Family GGDEF domain 0.0000991
Further Details:      
 
Domain Number 3 Region: 52-210
Classification Level Classification E-value
Superfamily Sensory domain-like 2.04e-33
Family YkuI C-terminal domain-like 0.0068
Further Details:      
 
Domain Number 4 Region: 375-484
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.29e-23
Family Heme-binding PAS domain 0.093
Further Details:      
 
Domain Number 5 Region: 217-321
Classification Level Classification E-value
Superfamily Sensory domain-like 6.91e-17
Family YkuI C-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302878855|ref|YP_003847419.1|
Sequence length 925
Comment PAS/PAC sensor-containing diguanylate cyclase/phosphodiesterase [Gallionella capsiferriformans ES-2]
Sequence
MSALNLKLKKKSVLFHLLIWFLPFALLVIASAVYLYKSEEQREFIAQSLSENAKISLAKG
AVEQTLEGIYSDTYLVAQNLSLQELIANKSSGLTWRFLHDLRLISQSRKHYDEISWIDET
GMERARVHFNGHHTNLIPEEKLTNKSTADYFTRTLGLNAGEIYVSPHDLDAESAELARKH
ILRIATPVVDINGYKHGVIVFNYPSEILVQKFISSAPTGDEHAMLVNRDGYYLEKSPGVE
TLSNPPYPDTQSIANSKPVAWQHIGGHTQGQFMTADGLWTFASIYPASITPSKRVAYSAD
FNATQNLDWKVVRHIPRAQLLSRTKVLGERLIPVSTLLLGLIFFSSLKHARTHVRAQLAE
TDLRIAATAFESEESMIITDSRGIILKVNQVFTATTGYTSEEAVGKTPSLLKTDRHSAEF
YHEMWRQIKQTGKWQGEIWDKRKNGEIYPKLLNIYAVKSKNGVVTHYVGSYTDLTERKMA
EEKIISLAFYDTLTGLPNRRLLLDRLNYALASGLRTGKNGALLFIDLDKFKTLNDTLGHD
IGDLLLKQVAHRLKACVREIDTVARIGGDEFVVMLEDLNIESVEAAAQTEVIGEKILAAL
RMPYQLLTNEFHSSVSIGISLFSNNGQSQDEPLKQADIAMYQAKKSGRNKLRFFDQRMQD
TISSRANLEAELRKALANEQLQLHYQIQVDSAHQTIGAEVLLRWIHPVNGIISPAQFVPV
AEETGLILPIGLWVLETACAQLKKWQDNPATAQLILAINVSARQFHQNGFATEVRSVIER
HDINPALLKLELTEGMLLNNLDDTIATMRSLQEFGVQFSLDDFGTGYSSLQYLKRLPLAQ
LKIDQSFVRDLATGYNDQAIVRTIIAMAHSLNLNVIAEGVETEIQRQILLKNQCSHFQGY
LFGKPMPIEQFESLLSSDSTAAACI
Download sequence
Identical sequences D9SGK8
gi|302878855|ref|YP_003847419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]