SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302879464|ref|YP_003848028.1| from Gallionella capsiferriformans ES-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302879464|ref|YP_003848028.1|
Domain Number 1 Region: 1161-1323
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-34
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 538-658
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.9e-19
Family Flavin-binding PAS domain 0.032
Further Details:      
 
Domain Number 3 Region: 1091-1168
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000981
Family Homodimeric domain of signal transducing histidine kinase 0.003
Further Details:      
 
Domain Number 4 Region: 864-975
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000209
Family Heme-binding PAS domain 0.066
Further Details:      
 
Domain Number 5 Region: 693-841
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000216
Family GAF domain 0.0067
Further Details:      
 
Domain Number 6 Region: 965-1087
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000262
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302879464|ref|YP_003848028.1|
Sequence length 1326
Comment multi-sensor signal transduction histidine kinase [Gallionella capsiferriformans ES-2]
Sequence
MKPVNFILAASPKILLLAGIYFLLGVASQQLAIPPGYASAVFPAAGVALAVILHSGYRLL
PGIWTGSFCLNLWIASCSGGIDDKTILIAAIVASGATLQTGVAALLIRRLLKGNWHNLDS
DTDIIRFLLLAGPVACLISSSWATVTLTMSGVISDHAWLFNWSNWWVGDSVGAMLFAPLT
LILLQRRGNTEKSRITNVAIPTLLVTAGIVALFVYVSGIEAIKVRQHIAEHGRTVSDQLK
SRIISYHEVIASLDNYLQATPDINRLKFERYTQSFFEDHPDLMALSWNPLIPQKSRRQFE
QTLSNEYSPARLTITERNLQNQLVSANVRDQYVAIGYISPLQSNRKALGFDILSNPMRAE
AIERAINSGQMAATAPIQLVQDSTANAGVLLLHPVYRNHTSATGHNKIAPRGFAVGVFRI
DKMLSELAVKNIPAELAFSLHDTAAPSENQTLYRLNVNRPLLSEYTWESDVAIGGRAWHI
TLSPTRAYLEENRSFLPWIVLAAGLTLVSLLQAFLLAITGRTSIVQRTVDQQTQILLESE
QRLRKQNEKNLAILHNASDGIHLLNASGDLIEASDSFFTMLGYQREEMINMHVSQWDALL
TGPELAQTIQLQFEKKERSQFQTVHRRKDGSTLDVEISSFPLELDGEIVLFYSSRDITAR
RIIEASLQQQLMFTRALNTISRTFVEQEENALLLTRTVVNVGAALGADRALIYDINFETQ
KIIGLSEYLNPEHADITATLATYPLQLFFGGASEIMSTHRWIISQRDDIEPHLALDGSGD
ILHRQMNIQSLLWYPFAFHNNGFHLLALNHIHAKKIWSAEELEFIESVSHLVSFELEKIR
LTDARKCADAERDRLLKIIEDAPDFIATCDMQNRLKYLNAAGAKLVGLPDNADLSALKIS
DMHPEWATQKMLNEDIPVVLEQGVWQGETALLHRDGHETPASQVLLVHRDADGNPEYLST
IIRDISGLKKYEKALLNNEQNLLNILKLSPIAVRIAVDRGQKVAFCNPRYADLIKSEDPL
GDTPTKYYANVADYHAILDELAKGNSVLNRMVELNIPGGTTTWALASYMPMQYDGADAVL
GWFYDISDRKEAETELLRSNIELEQFSYAISHDMRQPLRMISSYLQLLEMSLADQLNDEN
RDYIQYAVEGAKRIDQMLIALLEYSRVGRMNEDKAWHESRTLLDEALLFLQPAISEAQAK
ITLSGDWPPLFANGDEITRLLQNLIGNAVKYRIAGRPPEINLDGVRVNHEWHLCISDNGI
GIAPGQIKRLFQVFQRLQSREVYQGTGIGLALCRKIAEHHGGRIWVESSGEGMGSRFFVA
LPLTDL
Download sequence
Identical sequences D9SIV1
WP_013294187.1.12990 gi|302879464|ref|YP_003848028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]