SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298674232|ref|YP_003725982.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298674232|ref|YP_003725982.1|
Domain Number 1 Region: 163-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.04e-64
Family Actin/HSP70 0.000000791
Further Details:      
 
Domain Number 2 Region: 357-513
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.83e-61
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 1-160
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.72e-58
Family Actin/HSP70 0.00000287
Further Details:      
 
Domain Number 4 Region: 480-583
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 4.32e-17
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298674232|ref|YP_003725982.1|
Sequence length 616
Comment chaperone protein DnaK [Methanohalobium evestigatum Z-7303]
Sequence
MGKIIGIDLGTTNSCMAIMEGGEPNVIPNAEGSRITPSVVGFSKKGELLVGQVAKRQLIA
NPDNTVYSIKRHMGEQDYKVTLQDKEYTPQEISAKILRKMKDDTEDYLGEELQDAVITVP
AYFNDAQRQATKDAGRIAGFNVKRIINEPTAAALAYGIDKEEEQKILVYDLGGGTFDVSI
LDIGDGVYEVVSTTGDSHLGGDDFDQRLVNHLVKKFKEEEGLDLSQDRSALQRLTDAAEK
AKIELSSVTTTNVNLPFITADANGQPKHLDIDVSRSQFQQLTEDLVEETVDLMQQALKDA
NLTANDINKVLLVGGSTRMPAVTDAINKVVGKEPYKNINPDEAVAVGAAIQGGVLSGETE
ELLLLDVTPLTLGIETEGGVMTPLIERNTTIPTKKTQVFSTAEDNQTAVDVHVLQGERPM
AKDNQSLGRFRLEGIPAAPRGVPQIEVTFDIDANGILNVSAKDLGTNKEQSITIEKPGAL
SEDEINQMVKEAEEHAEEDKKRKEEVETRNRADTLVNSADKTLEEAKDVITEDEKSKIEN
AKSELQEALKGDDIEDIKSKTETLQNAIYEVSQKMYQQAQEQAQQQAETEGAESAGGSSE
EDVVDADYEDSDEKKQ
Download sequence
Identical sequences D7E6G4
gi|298674232|ref|YP_003725982.1| WP_013193754.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]