SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298675088|ref|YP_003726838.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298675088|ref|YP_003726838.1|
Domain Number 1 Region: 17-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000169
Family PYP-like 0.088
Further Details:      
 
Domain Number 2 Region: 232-304
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000837
Family MJ1460-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298675088|ref|YP_003726838.1|
Sequence length 306
Comment hypothetical protein Metev_1161 [Methanohalobium evestigatum Z-7303]
Sequence
MQNNQIQHDNNELKDYIIKSLPDNLTVLDTDGTILYVNDLWRIFASNNGLDPDMCSEGTN
YLDVCDHAYGKNSEEAYVAANGIRDVITGKKDIFELEYPCHAPDKNRWYLMKVIPLNKRY
PTPVLIYHLNITERKLSEIELQKKHEHIYKQNQIRKILTGTIPTLLKESPKDRRKIVVKQ
MLDMVENCMFHQNTSTLKSQQIDCKSSKFKYEDVNSNNVGYMSCEVMNQLGGDFSLESFD
KEGLRFAVKGTGCPWGAEQAKSNPILCNLTKGIISRVITKVYNDAKVETLKTMGNGDKCC
YFIIYK
Download sequence
Identical sequences D7E994
gi|298675088|ref|YP_003726838.1| WP_013194609.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]