SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298675233|ref|YP_003726983.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298675233|ref|YP_003726983.1|
Domain Number 1 Region: 134-252
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.62e-20
Family MJ1460-like 0.022
Further Details:      
 
Weak hits

Sequence:  gi|298675233|ref|YP_003726983.1|
Domain Number - Region: 12-90
Classification Level Classification E-value
Superfamily ACT-like 0.000168
Family AF1403 N-terminal domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298675233|ref|YP_003726983.1|
Sequence length 269
Comment 4-vinyl reductase 4VR [Methanohalobium evestigatum Z-7303]
Sequence
MTHNLGIFFSKEETGNYVWFKIHHSDTPKSQADIANLFASENVDVRYGYIDNTEYSDRGK
YVLFALVKQSVDINSFLDKLKKLDVVLNVEYEVMENGELHSLDYPLQLLGERAVITRATT
FVDVIHIIKENVSDSGGLLMMSGLNGGIHAARYIKKNIDIDKNNLINILKELVIAAGWGR
LEMDFDFETLDGRIYFMNCFIAEYYGKSEIPVCEYVSGFFSGFITEALNEPVHVREIRCK
SMNHDVCEHIISKAPHGMKPEHILRGDLP
Download sequence
Identical sequences D7E9B5
WP_013194753.1.99978 gi|298675233|ref|YP_003726983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]