SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298676207|ref|YP_003727956.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298676207|ref|YP_003727956.1|
Domain Number 1 Region: 121-245
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-21
Family Heme-binding PAS domain 0.045
Further Details:      
 
Domain Number 2 Region: 18-124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-21
Family Heme-binding PAS domain 0.057
Further Details:      
 
Domain Number 3 Region: 336-408
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000518
Family MJ1460-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298676207|ref|YP_003727956.1|
Sequence length 410
Comment putative PAS/PAC sensor protein [Methanohalobium evestigatum Z-7303]
Sequence
MTDNKEYASSHLKEFFYLFNNMNDAAFVHDLAGNFLDINNTAIQRLGYPKDELLSMGPHS
IDAPEYAEKVNNIIKQISEEKQLTFESVHITKSGERIPVEISSNIIQYKEQPAILSIARD
ITERKRAELNEKRYRLLFEKADDAIFILEGEGDGTGNIVDANQKAADIHGYSLDEILNMH
ITDLGTQSVADEFPLRLKRVFEGEWIKDELNHLDKNGNVIWMEVNAGQVELDGHKYIFAI
ERDITWRIQLETNLKQEHDQLEKQNQIRSILTGILPTLLKESPKEKRRVILKQMLDMIEK
CMFHGECLNMTQFEYNNINTSNVGYMSCEVINQLGGDFSVDTSNQNDVQFAIKGTGCPWG
IEQAKMNPILCNLTNGIIARTVSNVYKNPNVKTMKTMGNGDECCYFLIHH
Download sequence
Identical sequences D7EC38
gi|298676207|ref|YP_003727956.1|NC_014254 WP_013195724.1.99978 gi|298676207|ref|YP_003727956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]