SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296131746|ref|YP_003638993.1| from Thermincola potens JR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296131746|ref|YP_003638993.1|
Domain Number 1 Region: 8-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.19e-62
Family PP-loop ATPase 0.0001
Further Details:      
 
Domain Number 2 Region: 376-463
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.29e-24
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 213-321
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000000023
Family MesJ substrate recognition domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296131746|ref|YP_003638993.1|
Sequence length 471
Comment tRNA(Ile)-lysidine synthetase [Thermincola potens JR]
Sequence
MYEKVKATVIKYKMLEPGDKVVVGVSGGPDSVALAHILTRLAKEFRLTIHIGHLNHMFRG
KEAELDAASVARLAEKLGLPCTVERIDVPAYLSEHRVSAQAGARYIRYAFFEKLADEVGA
NRIATGHHADDQAETVLMNFLRGSGVSGLTGIPPVRQGKYIRPLIEVSRQEIENYCRYFD
LPVRFDASNAKNIYLRNRVRNQLIPFLQKEFNPKIVQTIARFSEIARDDNEFICREAEKA
WQLLGVEERTEEIRFELDRFWEWPRAVQRRILIKAWEAVTGSARDIMYTNIENLLEFLKT
GPASGYIELPKGIVAQKTYNSVIITAQYEPAQIEYDHELKVPGRTIIPEAGLTIITDVKQ
IAAYNMDAKAHGIDKGLKAHAVDYDRLHGDVRVRNRRPGDRFQPLGMRGTKKLKDFFIDL
KIPVAERDRYPVITAGDNIVCVGRLRIDERWKITESTRTVLIIKIIDEIDS
Download sequence
Identical sequences D5X9M1
WP_013119120.1.83787 gi|296131746|ref|YP_003638993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]