SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296132995|ref|YP_003640242.1| from Thermincola potens JR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296132995|ref|YP_003640242.1|
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.44e-27
Family YheA-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296132995|ref|YP_003640242.1|
Sequence length 131
Comment hypothetical protein TherJR_1488 [Thermincola potens JR]
Sequence
MTVLEKAKELAQAIAECDELKEVRAAETRMTLDPDAQDILREFQIKQREFYNIQVNGGEL
TEEQMRDVERIENRMSQNEYIRKFVGAQERFEALLNSVNMIIAQAISGNSGCGCGDNGAA
DCCDSGCSGCN
Download sequence
Identical sequences D5XFC0
gi|296132995|ref|YP_003640242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]