SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296133371|ref|YP_003640618.1| from Thermincola potens JR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296133371|ref|YP_003640618.1|
Domain Number 1 Region: 341-572
Classification Level Classification E-value
Superfamily PHP domain-like 1.57e-57
Family PHP domain 0.00043
Further Details:      
 
Domain Number 2 Region: 159-319
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.09e-44
Family DNA polymerase beta-like 0.0017
Further Details:      
 
Domain Number 3 Region: 6-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 2.75e-19
Family DNA polymerase beta, N-terminal domain-like 0.0021
Further Details:      
 
Domain Number 4 Region: 81-149
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.000000256
Family Achaeal helicase C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296133371|ref|YP_003640618.1|
Sequence length 575
Comment PHP domain-containing protein [Thermincola potens JR]
Sequence
MKKFGNIEVAWVLDEIAALLEIKGEDIFKIRAYQRAARAIENLDVDITDLFRQKKLNGIS
GVGKNIAAKLEELLSTGRLIYLEKLRGEIPPGLVEMMNVPGVGPKMARTFYEKLGISSLK
ELEDAARGKKVRSLPGMGSKTELNILRGIEMLKSGGRGRITLGLAWTVADSLLNFLRSLP
WVVEAETAGSTRRMKEAIGDIDIVVGTEEPEKVAEVFVKHPQVKEVLAHGSTKISVLLKF
GVQVDLRLVRPDEFWTALHHFTGSKEHNVRLRERAHKIGIKINEYGLFKTDSDERIPVSG
EEDIYTALGLAYIPPELREDRGEVFAAEEGRLPQVIGYDDMKGDLHLHSNWSDGVNSIEQ
IVEQAKKMGYEYIAITDHSRSLGIARGLSTERLTEQQEVINALQKEEAIHILTGVEADIL
ANGDMDYPDEVLAEKDIVIGSIHSGFRQDKEKITERIISAIKNEHVDIIAHPTGRLIGRR
DPYEVDMDRIFEMAAKYNTVLEINSSPDRLDLNDLYVRQAKEMGIKIAINTDAHEIIRMH
EIRYGIGTARRGWLEKEDVINTWDYDKLRRFLKNR
Download sequence
Identical sequences D5X7Z7
gi|296133371|ref|YP_003640618.1| WP_013120729.1.83787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]