SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296133604|ref|YP_003640851.1| from Thermincola potens JR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296133604|ref|YP_003640851.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 5.36e-71
Family Hsp33 domain 0.000000777
Further Details:      
 
Domain Number 2 Region: 233-288
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.09e-18
Family HSP33 redox switch-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296133604|ref|YP_003640851.1|
Sequence length 295
Comment Hsp33 protein [Thermincola potens JR]
Sequence
MDDLMVRGVAAGGLIRACAAVTTGLVEEARVRHKTEPTATAALGRVLTGAALLTSGLKEH
DTITLRVLGDGPLGAIVATADAHGNIRGYVQNPEVNLPPAGPGKLDVGLAVGKNGFLHIT
KDLGLKEPYTGSVPLRTGEIGDDLAAYFLVSEQVPSAVNLGVLVNPDGTVQSSGGYLIQL
MPGVKDEQIEEIENIIYSLQPISTLVSIGWGPRRILEEILGHLDFKQLEETELRFKCKCS
RERLETVLISLGKEEIESILALEGEAEVKCHFCGEVYRFNRHELEKIKEAAVSLK
Download sequence
Identical sequences D5X8S4
WP_013120952.1.83787 gi|296133604|ref|YP_003640851.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]