SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296134457|ref|YP_003641704.1| from Thermincola potens JR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296134457|ref|YP_003641704.1|
Domain Number 1 Region: 57-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.93e-26
Family Ribosomal protein L9 C-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily L9 N-domain-like 4.36e-20
Family Ribosomal protein L9 N-domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296134457|ref|YP_003641704.1|
Sequence length 147
Comment 50S ribosomal protein L9 [Thermincola potens JR]
Sequence
MKVILMEDVKKLGKKGDIVNVAEGYARNFLFPRNLAVEATQGNLKNLEQKKQAEMAKKAQ
LLQEAKNLAEKIEGLEIKVATKVGDGGKLFGSVTSKDVAEKLYEQHKIQVDKKKIEIDTI
KTLGTYQASVKIHPEVQARFTVKVVEG
Download sequence
Identical sequences A0A0L6W2C6 D5XDQ7
WP_013121791.1.83787 WP_013121791.1.95020 gi|296134457|ref|YP_003641704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]