SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300087567|ref|YP_003758089.1| from Dehalogenimonas lykanthroporepellens BL-DC-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300087567|ref|YP_003758089.1|
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.94e-26
Family Siroheme synthase N-terminal domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 112-199
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 6.54e-16
Family Siroheme synthase middle domains-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300087567|ref|YP_003758089.1|
Sequence length 213
Comment siroheme synthase [Dehalogenimonas lykanthroporepellens BL-DC-9]
Sequence
MRNRNYYPVFLDLTGKKCLVVGGGAVAWRKVESLLGSGAEVTVISPSLIPEINRLAEQSQ
VTIVNRVYAEGDLLGFFMVIAATDDVMVNGAVFREASKLGMLVNVVDDTANSNFIVPSVL
RRGDMAIAVSTSGSSPALARRIKSDLTDIFGEEYADVVSLVGQIREELLVKGVSIAPEKW
QTVLNLKLLAEKVKTGNQEEARNWLRQKLLEDR
Download sequence
Identical sequences D8JZJ0
gi|300087567|ref|YP_003758089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]