SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300088495|ref|YP_003759017.1| from Dehalogenimonas lykanthroporepellens BL-DC-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300088495|ref|YP_003759017.1|
Domain Number 1 Region: 69-96
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000559
Family Rubredoxin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300088495|ref|YP_003759017.1|
Sequence length 120
Comment hydrogenase nickel incorporation protein HypA [Dehalogenimonas lykanthroporepellens BL-DC-9]
Sequence
MHEMAVTQSLLDIVIKEAEKAGAKKVNAVNLVIGELSGLVDDSVQFYFDFLTKDTIADGS
RLVFRRVPARMKCRACEAEFSPEPDEWVCPQCDQWQAEVVAGKEFYIDSIEVDDDADKGA
Download sequence
Identical sequences D8K268
gi|300088495|ref|YP_003759017.1| WP_013218831.1.85799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]