SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300869788|ref|YP_003784659.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300869788|ref|YP_003784659.1|
Domain Number 1 Region: 14-137
Classification Level Classification E-value
Superfamily CheY-like 1.85e-32
Family CheY-related 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300869788|ref|YP_003784659.1|
Sequence length 140
Comment chemotaxis response regulator CheY [Brachyspira pilosicoli 95/1000]
Sequence
MPSTPLGFNSKNGKQYKVMIVDDSSIIRIAEKKILLSEDFNVVMEADNAMAALKYLREIP
DKPDIIMLDFEMPQMNGIDLLKRIRALNYEGKIVVVTSHTNKDTFMEFVNLKVDTYIAKP
IQRQIIIAHLARILGRFDYL
Download sequence
Identical sequences D8IAH7 K0JIP1
gi|434382062|ref|YP_006703845.1| gi|300869788|ref|YP_003784659.1| gi|431807146|ref|YP_007234044.1| WP_013243113.1.6222 WP_013243113.1.67631 WP_013243113.1.92922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]