SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300869949|ref|YP_003784820.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300869949|ref|YP_003784820.1|
Domain Number 1 Region: 5-125
Classification Level Classification E-value
Superfamily CheY-like 1.04e-34
Family CheY-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300869949|ref|YP_003784820.1|
Sequence length 130
Comment response regulatory protein [Brachyspira pilosicoli 95/1000]
Sequence
MLNGKPLILAVDDEENIRNLITYTLEAHDLEVLTAENGKVAITILEHNPVDVIITDLLMP
SMTGLALIREMKKRKNSIPIIIITAYGNTDMVKEIIAEGVFRLIEKPLDFETLVPIVNDA
IEYKKNNNKK
Download sequence
Identical sequences D8IAZ6 J9UNM4 K0JLE7
WP_013243274.1.48933 WP_013243274.1.6222 WP_013243274.1.67631 gi|434382356|ref|YP_006704139.1| gi|300869949|ref|YP_003784820.1| gi|404476277|ref|YP_006707708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]