SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300870079|ref|YP_003784950.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300870079|ref|YP_003784950.1|
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily CheY-like 7.26e-36
Family CheY-related 0.00026
Further Details:      
 
Domain Number 2 Region: 127-225
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.14e-27
Family PhoB-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300870079|ref|YP_003784950.1|
Sequence length 227
Comment transcriptional regulatory protein [Brachyspira pilosicoli 95/1000]
Sequence
MEKELIYSVEDDDNIRDLIKYTVEEAGFNIECFSNGKDMLEALKNNIPSLILLDIMLPDM
EGTDILKIIRTDYAHLPIKVIMLTAKSSEINIVTGLNLGADDYIPKPFSVLELIARIKAN
LRKKDVRVDTEELTFGEIKLIVKKRVVYVNDRQVSLTQKEFDLLKLLMENANNVVDREMM
LEEVWGVEHSMETRTIDMHIKSIRQKLDLKKENIITIRGMGYKLIEI
Download sequence
Identical sequences D8IBC6 J9USM0 K0JJT8
gi|434382509|ref|YP_006704292.1| gi|431806874|ref|YP_007233772.1| gi|404475606|ref|YP_006707037.1| gi|300870079|ref|YP_003784950.1| WP_013243404.1.48933 WP_013243404.1.6222 WP_013243404.1.67631 WP_013243404.1.92922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]