SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300870093|ref|YP_003784964.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300870093|ref|YP_003784964.1|
Domain Number 1 Region: 193-372
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.49e-61
Family Methylesterase CheB, C-terminal domain 0.00000265
Further Details:      
 
Domain Number 2 Region: 3-110
Classification Level Classification E-value
Superfamily CheY-like 1.71e-25
Family CheY-related 0.000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300870093|ref|YP_003784964.1|
Sequence length 377
Comment response regulator receiver modulated CheB methylesterase [Brachyspira pilosicoli 95/1000]
Sequence
MANKIKVLSIDDSALIRQLLTKIVNSDPDLEMVATAANPILAEAKLKTIKPDIITLDIEM
PEMDGITYLKKLMINNPIPVIMFSSLLDKHRELALDALNIGAFDYVIKPSANVRGGVEEL
ATDLVEKIKNAYNNRAKFYKKHGVAMPTETTTNITHNRVVVEAPKTSGFKVYPKNNADII
LPLVPSREVAMDKIILIGSSTGGTEALIECLKNVTPSAPPIVIAQHMPEHFTTSFARRLN
TVLKIEVFESEDGMSIGRGQAVLARGGKHTMIKVKNGKYYIEVVDGEPVTRHKPSVDVLF
RSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQNEETCTVFGMPREAIARGGV
DEILPLDRILAAALKKA
Download sequence
Identical sequences D8IBE0 J9USK7 K0JJU9
gi|300870093|ref|YP_003784964.1| gi|434382524|ref|YP_006704307.1| gi|431806861|ref|YP_007233759.1| WP_013243418.1.48933 WP_013243418.1.6222 WP_013243418.1.67631 WP_013243418.1.92922 gi|404475591|ref|YP_006707022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]