SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300870271|ref|YP_003785142.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300870271|ref|YP_003785142.1|
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily CheY-like 5.27e-37
Family CheY-related 0.0013
Further Details:      
 
Domain Number 2 Region: 287-422
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.74e-29
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00021
Further Details:      
 
Domain Number 3 Region: 148-271
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-25
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300870271|ref|YP_003785142.1|
Sequence length 426
Comment UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Brachyspira pilosicoli 95/1000]
Sequence
MTKNNILIIDDEEDILNACKNVLEDEGYDVDIAKNYEEALKTFESKKVDLVFLDVWLPNV
DGLDILSNIKEKYPDTAVIMMSGHAGVETAVRATKMGAYDFLEKPISVSKLLSSCDEIFK
KNENSIENNTSNNNNTHHHKTNNKYKVKQRTIAKSIVVSGFALMEGRKTALTLVPAEVNT
GIVFVDINTNTQIKLDHTNILSKDKSGAVNSTALVAGNRYIKTTEHFLAALHMMGITNLI
VKCDGEVPNVDGSALVFCDALREAGFVEQDDYIEPIVIDETLTYGNVNDNETYIILSPYN
GLEVSLRIDFAGTIGVQEYTYKFDNFEQFTEEVGRARSFNTIDNIDYAQKMGMAGSGMIG
SHILLCDGKVINTKLHFDNEFVRHKILDIIGDLYILGRPIIGRVVANKSSHSFNHSVVHD
LANRYL
Download sequence
Identical sequences D8IBW8
WP_013243595.1.6222 gi|300870271|ref|YP_003785142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]