SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300870447|ref|YP_003785318.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300870447|ref|YP_003785318.1|
Domain Number 1 Region: 76-198
Classification Level Classification E-value
Superfamily CheY-like 1.85e-21
Family CheY-related 0.0013
Further Details:      
 
Domain Number 2 Region: 19-63
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000751
Family Excisionase-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300870447|ref|YP_003785318.1|
Sequence length 202
Comment diguanylate cyclase [Brachyspira pilosicoli 95/1000]
Sequence
MDFDKNVIYEDDDLLSPIDVSKILGVSRTTVNYWVRHYGLKADVTPGKRYKIRYADLKVF
LAFNKRDKRAKLKRKVSKYKIAIIEPIEITRKNYLQWLRNDYEVSIVSNLTNPLNELKKI
LPDIILMDINLSDDKDYFYLLDEIKKEISLRMALIIIITKKYNEDDVVNGLEKGACDYVQ
KPVGQNELNARIKNALRFYIDV
Download sequence
Identical sequences D8ICE4 J9USB5 K0JKN6
WP_013243771.1.48933 WP_013243771.1.6222 WP_013243771.1.67631 WP_013243771.1.92922 gi|404475215|ref|YP_006706646.1| gi|300870447|ref|YP_003785318.1| gi|434382912|ref|YP_006704695.1| gi|431808720|ref|YP_007235618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]