SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300871116|ref|YP_003785988.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300871116|ref|YP_003785988.1|
Domain Number 1 Region: 175-333
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.2e-20
Family GGDEF domain 0.0034
Further Details:      
 
Domain Number 2 Region: 4-144
Classification Level Classification E-value
Superfamily CheY-like 7.68e-17
Family CheY-related 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300871116|ref|YP_003785988.1|
Sequence length 340
Comment response regulatory protein [Brachyspira pilosicoli 95/1000]
Sequence
MNENILVIEHRAELLEKIVDILKERHYNPISTKSRSQAINISNETSIDLIIIDADIGDSQ
GLQLLDTFKNQENTKGIPVILLSTPYKKIEFIEEAISLDIDGLVFTPFDEMEFIVNVHNA
MKQKKMYIEHQKTLKQIDYLQNALNNMTETSNKNYQSYKDSQKKYEEILNIDLETGFYNK
KEFLIQFKRLLAETVRHEETIILASFSIDGIDDIIEEFGIMAGEEIILQFSKVLTNAARE
EDIITRYDTNLFMVAFKRMDIRLYEDKIEQIKELVNKNEIMYNEIVIKYTVSAGIAYTAY
KANYHFDNLDKEIAPSLLALHNAKRRGFAKVYIHPTVIRR
Download sequence
Identical sequences D8IEB4 J9UY07 K0JG75
WP_013244437.1.48933 WP_013244437.1.6222 WP_013244437.1.67631 WP_013244437.1.92922 gi|431808122|ref|YP_007235020.1| gi|404477120|ref|YP_006708551.1| gi|434381054|ref|YP_006702837.1| gi|300871116|ref|YP_003785988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]