SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300871358|ref|YP_003786231.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300871358|ref|YP_003786231.1|
Domain Number 1 Region: 11-146
Classification Level Classification E-value
Superfamily CheY-like 4.98e-25
Family CheY-related 0.0016
Further Details:      
 
Domain Number 2 Region: 179-385
Classification Level Classification E-value
Superfamily PP2C-like 0.00000085
Family PP2C-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300871358|ref|YP_003786231.1|
Sequence length 388
Comment response regulator receiver modulated serine phosphatase [Brachyspira pilosicoli 95/1000]
Sequence
MASTRNNILTEKVLIVDTNIDYAKFIQKFLKKNNYLCYIALSYEEAINMTYEKIPDCILV
DYMLPNAGACRLAGYIKSDNLLKNIAVLFLTASDNKTESLKAFDCGADGFFEKSIDTDLF
LSKMKSYIRLKKAIESNMMYMDILKRDIEYAAKLQKTILSYGNTSIPKNEISIHHYAPNE
VSGDYSGIKLINDGYYAILLADVSGHGVAASMLTILIKSFFDSHAIIDDKNTSPAIFLEK
LNKFFIEEGFDKNLFACVFYALYNNDTGALLCSSAGSPKPIYYSNGKDEICTVDIDGPLI
GMIDDSEYTEMEIQLNRNDILFVFTDGAYEVFDDNNNMFGDEHLKQIFSKNVKNNVSDIK
EKIINEIKSFTKEPLKDDVSMILLKRTN
Download sequence
Identical sequences D8IF07
WP_013244679.1.6222 gi|300871358|ref|YP_003786231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]