SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300871520|ref|YP_003786393.1| from Brachyspira pilosicoli 95/1000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300871520|ref|YP_003786393.1|
Domain Number 1 Region: 142-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-71
Family Extended AAA-ATPase domain 0.000000755
Further Details:      
 
Domain Number 2 Region: 1-186
Classification Level Classification E-value
Superfamily CheY-like 1.85e-45
Family CheY-related 0.00048
Further Details:      
 
Domain Number 3 Region: 355-445
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-16
Family FIS-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300871520|ref|YP_003786393.1|
Sequence length 446
Comment response regulatory protein AtoC [Brachyspira pilosicoli 95/1000]
Sequence
MPKILVIDDEKNIRDGIKKSLEYEGYEVVTAENGEKGIETVYKGGIDLVITDLKMPEKTG
EEFLHDILEFDKHIPVIILTGHGNIETAVDMMRLGAYDFMTKPFNIDKMLLIIARALENK
NIKKTNETLEKRVDYHESFYGMIGHSSKMLKVYEAIKQVARTKATVLIEGESGTGKELVA
NAIHQISDRAKQPYITVNCAALSEGVLESELFGHEKGSFTGAIDKKIGRFEAANKGTIFL
DEIGEINQVVQVKLLRVLEERVIERVGSNTPISVDIRVIAATNKKLSEEIKEGRFREDLY
YRLNVIKIEMPPLRERREDIPLLIDNFIKEFSQVHNIEITNVDKKVYKLLSSLQWEGNVR
ELRNTVETMVVMSKDGKIDESNIPNWVLTSSTDDFIIDKEMTLEELEKKYINHLLSKNNF
NKAQVAKILGIERATLYRKLKDYNVD
Download sequence
Identical sequences D8IFG9 J9UVK4
WP_013244841.1.48933 WP_013244841.1.6222 WP_013244841.1.92922 gi|431807728|ref|YP_007234626.1| gi|404476581|ref|YP_006708012.1| gi|300871520|ref|YP_003786393.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]