SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|402552393|ref|YP_006601110.1| from Mycoplasma genitalium M2288

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|402552393|ref|YP_006601110.1|
Domain Number - Region: 272-383
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000942
Family FCH domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|402552393|ref|YP_006601110.1|
Sequence length 650
Comment hypothetical protein CM5_00540 [Mycoplasma genitalium M2288]
Sequence
MKTQKNIFKVKALLLSLFSAAVTITIFALPIFANNGSKTDLGLLSKNSADFLGSSKRSLA
GFDTPFSPDNLQYLEKETDYDQNFKNFTEKFKDEKITNNQLDIVDIYNLFSGFHKSVKNT
VDLMSQLQKQVEAANAIFPVDDAFVKLPKVPTELFKLVDDNVFPKLNPKGLNISDNIAAL
FERYNLKSIELKNFDLAFLRKADVIIKDKVRYNFEMQMQFQTVYVGGGNTVINLDFTLKA
QTANFANLQDLQNSFVKVGNDLSTQLFWIPTVNKLTDNAGNDLTHIAKTVIGESFFQTNV
NLAKSVIEYDKVQPLVKQAFEERVLTPFKKEREAAKKAYEEEQRRLEEERKRQLEELRRR
EAEEKRKAEEAKRNQEKARREREAYEKSFNSFKDFKFYWLTKGKDVTKKADLIDALKTAI
ATPAYRNRTFSLLIKGFASGVERYFNANKNDKELKKLAFGEKGIQFPRADAGIDGLYMSN
FLRHELTSKAKFSLNLKDIKVENTVEDTQLYWKDNGIHLKQANPYKFNLNIKIKYNGWYN
VHWWNWLPAKILGIPTDWSGEMNLTFVVNGDLSEIVDKHDYPGTFFQFTDKNELLFTLAV
REQIKVDNNHFMGLLKSQNLHDLQLASGATKPPVVDLASYFHFVLLTEKS
Download sequence
Identical sequences WP_014894567.1.68365 gi|402552393|ref|YP_006601110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]