SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300309961|ref|YP_003774053.1| from Herbaspirillum seropedicae SmR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300309961|ref|YP_003774053.1|
Domain Number 1 Region: 193-379
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.53e-68
Family Methylesterase CheB, C-terminal domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 6-135
Classification Level Classification E-value
Superfamily CheY-like 1.11e-29
Family CheY-related 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300309961|ref|YP_003774053.1|
Sequence length 381
Comment chemotaxis-specific methylesterase [Herbaspirillum seropedicae SmR1]
Sequence
MSTPAMIRVMVVDDSSVVRQLMQQVLAQTPDIRVIGTAPDPVFALRKMQQQWPDVIVLDI
KMPRMDGVSFLRQIMATRPTPVIMCSAHVGPDNALAAEALAAGAVSVIARPQLGVRDFLQ
QAVEELASAIRAAMQAREGQRAPKAPARLGLSPVKAGAREMLHDAAWGAVLQRYTADAVL
QPPGPEDGLRPATARIVAIGASTGGPQALERVLGKLSQRCPGIVVVQHMPQRFTRSFAER
LHRISGAEVKEAEHLDRILPGRVLIAPGGRHLVVRREGLQYYVETLDGPLVSRHKPSVDV
LFRSLAKAAGSNAVGIIMTGMGDDGARGMRELADCGGATYAQDEASSVVFGMPKEAIQQG
GVGDVITLEHISAVIEQYACR
Download sequence
Identical sequences D8IYI5
gi|300309961|ref|YP_003774053.1| WP_013232663.1.82484 WP_013232663.1.93079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]