SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300312321|ref|YP_003776413.1| from Herbaspirillum seropedicae SmR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300312321|ref|YP_003776413.1|
Domain Number 1 Region: 156-340
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.29e-57
Family Methylesterase CheB, C-terminal domain 0.0000286
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily CheY-like 3.13e-21
Family CheY-related 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300312321|ref|YP_003776413.1|
Sequence length 342
Comment protein-glutamate methylesterase [Herbaspirillum seropedicae SmR1]
Sequence
MKIGIVNDTPMMVEVLRRVIAESGRHELIWIARDGEQAVQMCAWQLPDVVLMDLLMPKVD
GAEATRRIMEATPCPILVVTSDMDTSADKIYEAMGYGALDATQTPALIGAAGKRDAAALI
EKIDNLGRLSPEMVSPPVRGGRAETLAPAQPARADSLPPLVAVGASAGGPAALATLLKAI
PQGFAGAVVIVQHIDAAFAPGMAQWLQQQSALKVGLAQEGQAPQRGAVLLAASNRHLVVK
EGGRLGYVEGAPNDVYRPSVDVFFQSIVRHWPGKVAGLLLTGMGRDGAAGLKALRDSGAH
TMAQDQKSCAVYGMPKAAVALNAAVEVLPVTGMAARLQAIIV
Download sequence
Identical sequences D8J0E9
WP_013234974.1.82484 WP_013234974.1.93079 gi|300312321|ref|YP_003776413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]