SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300313268|ref|YP_003777360.1| from Herbaspirillum seropedicae SmR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300313268|ref|YP_003777360.1|
Domain Number 1 Region: 135-288
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.44e-34
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0069
Further Details:      
 
Domain Number 2 Region: 63-116
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000215
Family AraC type transcriptional activator 0.0027
Further Details:      
 
Domain Number 3 Region: 11-60
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000645
Family AraC type transcriptional activator 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300313268|ref|YP_003777360.1|
Sequence length 288
Comment transcription regulator protein [Herbaspirillum seropedicae SmR1]
Sequence
MSDERKKAYQARFERVLDHIEAHLHAPLEVEQLANVAHFSRFHFQRQFADFTGVGVARYI
LLMRLKHASLQLAFQPQRRIIDIALEAGFENPESFTRAFRSAFGQSPSQFRRAPDWPSWH
ERFVFRIPERKVDVQVEITHVEPIRIALLAHRGPVNGLNATVAQFIAWRKASGLSPVERC
RTFGLAWDNPDTTPPEQFRFGICGELEGDLPGNAQGVVESLIPGGRCARVRHVGAHERLG
DSIYPLYRQWLPESGEELRDFPLYFHYLNLLPDTPPGELLTDIYLPLK
Download sequence
Identical sequences D8ISN6
gi|300313268|ref|YP_003777360.1| WP_013235912.1.82484 WP_013235912.1.93079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]