SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|300313966|ref|YP_003778058.1| from Herbaspirillum seropedicae SmR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300313966|ref|YP_003778058.1|
Domain Number 1 Region: 100-263
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.96e-37
Family PA2201 C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300313966|ref|YP_003778058.1|
Sequence length 322
Comment hypothetical protein Hsero_4684 [Herbaspirillum seropedicae SmR1]
Sequence
MTRAPFCDEAYWNKWIHFGGESIADQLDRLGRPSGNPSYRPQYAFTIVSNYLELMLMHYS
RGDSAEVVTQHLPDLISAWEEAERLHLEIMSSEDYWRKFNWSTNLDHYIVCFWITGLALC
SPLGEDGWKRLIALMGNEGKDRLLDTILASRQQNRVIGTTLCHPKPYQQLLDVVTCDPEQ
QAHALQRFVSTWYADLDRPPANKKLSSDTALYNRPFWYKYGEHNRQGGAYFGQWCVEAVA
VAKLFGIDDSLCVGHPQYPGDLLRPGVVTPPDLQRLPASLKKWPPDTPAEENASGSENDA
AQKSSTTASRGWLARLFSRNRD
Download sequence
Identical sequences D8IY28
gi|300313966|ref|YP_003778058.1| WP_013236601.1.82484 WP_013236601.1.93079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]