SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302344788|ref|YP_003813141.1| from Prevotella melaninogenica ATCC 25845

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302344788|ref|YP_003813141.1|
Domain Number 1 Region: 283-578
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.35e-82
Family DNA repair protein MutS, domain III 0.00000176
Further Details:      
 
Domain Number 2 Region: 582-818
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-57
Family ABC transporter ATPase domain-like 0.00000119
Further Details:      
 
Domain Number 3 Region: 129-282
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 3.53e-38
Family DNA repair protein MutS, domain II 0.00039
Further Details:      
 
Domain Number 4 Region: 4-129
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.45e-36
Family DNA repair protein MutS, domain I 0.000065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302344788|ref|YP_003813141.1|
Sequence length 886
Comment DNA mismatch repair protein MutS [Prevotella melaninogenica ATCC 25845]
Sequence
MAKDDKGLTPMMKQFFSMKAQHPGALMLFRCGDFYETYGEDAVESARILGITLTRRNNGG
NGDSIEMAGFPHHALDTYLPKLIRAGKRVAICDQLEDPKKKREAIKGKKGLSAMDKMVKR
GITELVTPGVAMSDNVLNYKENNFLAAVHFGKGSCGVSFLDISTGEFLTGEGTFDYVEKL
LGNFQPKEVLFDRAKKQDFERYFGTRLCTFEMDDWVFTDQTARQKLLKHFGTKNLKGFGV
DHLNNGVVAAGAILQYLEITQHTQINHITSLARIEEDKYVRMDRFTIRSLELIAPMNEDG
SSLLNVIDNTITPMGGRMLRRWMVFPLKDEKPINERLDVVDYLFREPDFRECINEQFHRI
GDLERIISKVAVGRVSPREVVQLKNALMAIQPVKTVCLYTKSDTLKRIGEQLNLCESLRD
RIEKEIQPDPPQLVNKGDVIALGFNQELDDLRSIRDNGKQYLLEIQEKEIAQTGITSLKI
GFNNVFGYYLEVRNTFKDKVPENWIRKQTLAQAERYITPELKEYEEKILGADEKILALET
QLYMELIQDMQEFIPQIQINANLIAHLDCLLSFMKVSQLQRYVRPVVDDSEVIDIKQGRH
PVIETQLPIGEQYVPNDVLLDTEHQQIMMITGPNMAGKSALLRQTALIVLLAQIGCFVPA
ERARIGMVDKIFTRVGASDNISLGESTFMVEMTEASNILNNVTPRSLVLFDELGRGTSTY
DGISIAWAIVEYLHEHSRAQARTLFATHYHELNEMEKNFPRIKNFNVSVKQVDGKIIFVR
KLEKGGSEHSFGIHVAEIAGMPRSIVKRANVILKELEKDNSQVGSVGKAAVERLDQSREG
VQLSFFQLDDPVLTQIRDEILGLDVNNLTPVEALNKLNDIKKIVKG
Download sequence
Identical sequences D9RT95
gi|302344788|ref|YP_003813141.1| WP_013264085.1.27434 WP_013264085.1.55251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]