SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302345135|ref|YP_003813488.1| from Prevotella melaninogenica ATCC 25845

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302345135|ref|YP_003813488.1|
Domain Number 1 Region: 393-590
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.1e-28
Family ABC transporter ATPase domain-like 0.00049
Further Details:      
 
Weak hits

Sequence:  gi|302345135|ref|YP_003813488.1|
Domain Number - Region: 122-314
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0889
Family DNA repair protein MutS, domain III 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302345135|ref|YP_003813488.1|
Sequence length 598
Comment MutS domain V protein [Prevotella melaninogenica ATCC 25845]
Sequence
MYQHKAEETSKTLVSLRNRSRVFILTEIGSFLVAIGFVVLYTLFDNAAWTLFCALAALLF
YLYIRRRDVLNDRKINKGEALLLVYQNEIAYQKGDYSGFEAGGQYVSPQHSYTFDMDVFG
IGSLFQRMNRTISTGGSDQLAACLSTEWGSAKREELVGQIRQRMASIDELGKEETFLSEF
KSLGVKGRINTEEVLKALTDVHSQSFPKFFHSSLLCYFCYADLLGFYVSIVLSIVGLVPF
LLPVWWGIFNFMFSFLCGHKHMRVISELIAKAHTQVDGYLRVLKLVNKTEFKSAELQALK
QKLAGAEESFEQLELILQKIDNRSNEVGVFVFNSFALIDIAIVRLFLRWQHTYEQRTNEW
IDSLNLFDALVSMGNFRLNEDRAVQAEISEENKVVYDAKDLYHPFLGEKAVANDFTIHDH
EYYIVTGANMAGKSTFLRSLGINYLLAMNGLPVFAEHLKVSVFHLFTSMRTTDDLTHGIS
YFNAELLRLKKLLGSLRDDVPSLIILDEILKGTNSLDKLNGSRLFLQYIAERNVTGVIAT
HDLELSKMEEEYAGRFHNYCFEIELGEDITYSYKITKGVARNQNATFLLKGILNPNRI
Download sequence
Identical sequences D9RTR8
gi|302345135|ref|YP_003813488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]