SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302346423|ref|YP_003814721.1| from Prevotella melaninogenica ATCC 25845

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302346423|ref|YP_003814721.1|
Domain Number 1 Region: 61-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 2.22e-19
Family Ribosomal protein L9 C-domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00000000000000401
Family Ribosomal protein L9 N-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302346423|ref|YP_003814721.1|
Sequence length 175
Comment ribosomal protein L9 [Prevotella melaninogenica ATCC 25845]
Sequence
MEIILKEDIIGLGYKNDIVNVKNGYGRNYLIPTGKGIIASPSAKKQLAENLKQQASKLAA
LKAEAEKKAAQLDGVELVIATKVSATGVTYGSVNAATVVEELAKRGIEIDRKIVTMRDMK
KVGTSEATVHFHKEVEVKIPVTVVAENQPAPAVEEAPVEQPAEAPVAEEETPAAE
Download sequence
Identical sequences D3I506 D9RVJ5 X6PXN6
gi|302346423|ref|YP_003814721.1| WP_004359905.1.27434 WP_004359905.1.49139 WP_004359905.1.55251 WP_004359905.1.88943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]