SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302346546|ref|YP_003814844.1| from Prevotella melaninogenica ATCC 25845

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302346546|ref|YP_003814844.1|
Domain Number 1 Region: 364-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.71e-34
Family ABC transporter ATPase domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 26-300
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.66e-19
Family DNA repair protein MutS, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 830-904
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000523
Family Smr domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302346546|ref|YP_003814844.1|
Sequence length 905
Comment MutS2 family protein [Prevotella melaninogenica ATCC 25845]
Sequence
MKVMIYPKNFEQKIGFTEVRSLLRARCLSPLGKERVDAMSFSTDAVQVNTWMEEVREFRR
IQEGQDDFPLDNFFDVRESVARIRLEGTHMEVEELFDLKRSLETIIAIVNFLSRGEETEQ
GEIRHFYPALYNLADGVATFPLLVQRISQIIDKFGKMRDNASPELLQIRRELARIEGSIS
RTLYGILRAAQGEGLVEKDVTPTLRDGRLVIPVAPGLKRKISGIVHDESATGRTVYIEPT
EVVEANNKVRELENEERREMIRILTDFAKKVRPNVREILDSYNLMAAVDFIRAKAELARL
FKSFEPQVAEEPHIDWIRAIHPLLQLSLERKHNNKLNASLSVDNKEIDKVSNEVDNTQYY
DTVLEEENDTRNVPSSVVPLDIQLTKDKHLLIISGPNAGGKSVCLKTVGLLQYMLQCGLS
IPVGDRSTTGIFTDIMIDIGDEQSIENDLSTYSSHLMNMKVMMRRASESTLILIDEFGTG
TEPQIGGAIAESVLRQFWKKHAWAVITTHYQNLKHFAEEHPGTVNGAMLYDRHEMRPLFQ
LAIGRPGSSFAIEIARKTGIPEEVIRDASEIVGSDYIQSDKYLQDIVRDKRYWENKRQII
HSHEKELEKSIGQYEKDIAALEQSRKEILNRAKAQAEEIIKESNRRIENAIREIREKQAE
KEETKRIRQELAAYEAGLTDAGKTDKSDTSNKKKLKSSGLLSDDDFQKKVDKIKSRKERH
EQHLKEKASKQQAAAEALKNAVRKQQGGGLVMAGDSVRIKGLTSVGKVESIEGKQATVIF
GGMRTKMAISRLEHVDAETIQSEQKQFQAYNYSRETRETIDKHRNQFRQELDVRGMRADE
ALNQVQYFIDDAILVGASQVRILHGKGNGILRQLIRQYLGSVPNVTNYRDEHVQFGGAGI
TVVEL
Download sequence
Identical sequences D9RVW8
gi|302346546|ref|YP_003814844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]