SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302346722|ref|YP_003815020.1| from Prevotella melaninogenica ATCC 25845

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302346722|ref|YP_003815020.1|
Domain Number - Region: 47-143
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0602
Family DNA repair protein MutS, domain III 0.026
Further Details:      
 
Domain Number - Region: 146-270
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0602
Family Type II DNA topoisomerase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302346722|ref|YP_003815020.1|
Sequence length 281
Comment transposase [Prevotella melaninogenica ATCC 25845]
Sequence
MFEDNIGESLSIDETCLSCGEVYTFLTNKAGKGREGTLVAVVKGTKAEDVIQILKKINLS
KRKTVKEITLDLSSSMMRIARAVFPKALITNDRFHVQKLYYDALDDMRIAYRWMARDKEN
EEIKEAKCKGKEYIPFRYSNGDTRKQLLARAKFILTKHKTKWTETQKGRAEIIFEHYPTL
KKAYDLAMKLTDIYNIKSIKDAARLKLAKWFNEVEELGVDNFYTVIDTFENHYQTILNFF
VNRATNANAESFNAKVKAFRAQFRGVTDIPFFLYRLMKLCA
Download sequence
Identical sequences D9RWE4
gi|302346722|ref|YP_003815020.1| gi|302346924|ref|YP_003815222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]