SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564287515|ref|YP_008873712.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564287515|ref|YP_008873712.1|
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily GlnB-like 8.15e-31
Family Divalent ion tolerance proteins CutA (CutA1) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564287515|ref|YP_008873712.1|
Sequence length 102
Comment divalent cation transporter [Haloarcula hispanica N601]
Sequence
MPTIYITAPQEAATEIAQTLVEERLAACVNRVACDSIYRWEGEIHTDAEEILLAKTTADR
YPDLRDRVVELHPYEVPCIERFDETDIFVPFSDWRTRNVDAE
Download sequence
Identical sequences G0HZA7 V5TSE0
gi|564287515|ref|YP_008873712.1| gi|344209509|ref|YP_004785686.1| WP_014030587.1.67629 WP_014030587.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]