SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564287808|ref|YP_008873816.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|564287808|ref|YP_008873816.1|
Domain Number - Region: 92-156
Classification Level Classification E-value
Superfamily GlnB-like 0.063
Family Divalent ion tolerance proteins CutA (CutA1) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564287808|ref|YP_008873816.1|
Sequence length 181
Comment hypothetical protein HISP_16475 [Haloarcula hispanica N601]
Sequence
MDDPYHIGFVANKTPDARELYNRCQQAGLKTTHDGEADIVAEYRIGLTGHTDSSLEDALN
ALEQTENGSMRFWTEADMMIRVGISHPTTEDEQMMGCVNIGFQTSEIYGGAHPDSTYRAR
IDELLDIVAEIVPTVEPKYVWSSVYKGHEDYERFVPDGEPIANNIENLSSVPHKTSPVNL
T
Download sequence
Identical sequences G0HYM2 V5TRT8
WP_014030794.1.67629 WP_014030794.1.92404 gi|564287808|ref|YP_008873816.1| gi|344209730|ref|YP_004785907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]