SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564287961|ref|YP_008874152.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564287961|ref|YP_008874152.1|
Domain Number 1 Region: 82-197
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.17e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0065
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000698
Family Tetracyclin repressor-like, N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564287961|ref|YP_008874152.1|
Sequence length 199
Comment TetR family transcriptional regulator [Haloarcula hispanica N601]
Sequence
MTNEISFFQNPDGTREEILEATFYALRQHGYADLTISKIGDEFGKSQSLIYHHYDNKDEL
LVDLLDYMLEQVENQVPLPNQSPEEYIEIIVDEIFGTSSNSDVEFSQAVIELRAQAAHDD
DYNRLFRRSDDFIRKQIARVIRAGVDAGAFDVEDPSQTAALFHTVLVGIQAERITSDEET
IDDVRAEFRRYVENCLLSE
Download sequence
Identical sequences A0A0B5GNS6 A0A166FXZ7 M0K9R3 V5TTR7
gi|564287961|ref|YP_008874152.1|NC_023012 gi|564287961|ref|YP_008874152.1| WP_008311719.1.13069 WP_008311719.1.27393 WP_008311719.1.67629 WP_008311719.1.92404 WP_008311719.1.92869 WP_008311719.1.94779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]