SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564287964|ref|YP_008874155.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564287964|ref|YP_008874155.1|
Domain Number 1 Region: 80-195
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000134
Family Tetracyclin repressor-like, C-terminal domain 0.0078
Further Details:      
 
Domain Number 2 Region: 11-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000139
Family Tetracyclin repressor-like, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564287964|ref|YP_008874155.1|
Sequence length 198
Comment transcriptional regulator [Haloarcula hispanica N601]
Sequence
MTTDGDALGATEKEIMHATHRALVNSGYAELSISLIADELDKAKSTIYHYYDSKDDLLIR
FLRFTVDRFEATINTTIGDHPKEDLHHIITTLLPCQLTEEKRQLHSVLVTLSPQALDQEV
FREQFTEIDIRLTAIIEKTVRRGIEADVFRDVDPTHMAEHILAMIKGTMYSRLTTNREAA
TGAAKASLFSYIDSHLIS
Download sequence
Identical sequences A0A0B5GZC7 A0A165L9T0 G0HZS0 V5TSR5
gi|344209949|ref|YP_004786125.1| WP_014031003.1.13069 WP_014031003.1.27393 WP_014031003.1.67629 WP_014031003.1.92404 WP_014031003.1.92869 gi|344209949|ref|YP_004786125.1|NC_015944 gi|564287964|ref|YP_008874155.1|NC_023012 gi|564287964|ref|YP_008874155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]