SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288180|ref|YP_008874393.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288180|ref|YP_008874393.1|
Domain Number 1 Region: 81-195
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.2e-18
Family Tetracyclin repressor-like, C-terminal domain 0.0058
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000108
Family Tetracyclin repressor-like, N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564288180|ref|YP_008874393.1|
Sequence length 196
Comment TetR family transcriptional regulator [Haloarcula hispanica N601]
Sequence
MAGPSDRTFSDQTEEIMQATYRALREHGYADLTIKRIADEYGKSTAAVHYYYDTKDDLLA
AFLDYLLERFVDSIHDVETTDPEARLEILLDELLVKPQENPDLSVALLEMRSQAPYKEAF
SDRFRQNDEYIRYMLKAVINHGIDEGVFSDVDADHVTRSLLTIIDGARTRAVMLDDTEEL
ETARQTASEYADAMLR
Download sequence
Identical sequences A0A0B5H1Q7 A0A165L7J7 G0I0F8 M0K989 V5TSY2
WP_008312200.1.13069 WP_008312200.1.27393 WP_008312200.1.67629 WP_008312200.1.92404 WP_008312200.1.92869 WP_008312200.1.94779 gi|344210187|ref|YP_004786363.1| gi|564288180|ref|YP_008874393.1| gi|344210187|ref|YP_004786363.1|NC_015944 gi|564288180|ref|YP_008874393.1|NC_023012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]