SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288181|ref|YP_008874394.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288181|ref|YP_008874394.1|
Domain Number 1 Region: 74-188
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.17e-18
Family Tetracyclin repressor-like, C-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily Homeodomain-like 1.95e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564288181|ref|YP_008874394.1|
Sequence length 199
Comment TetR family transcriptional regulator [Haloarcula hispanica N601]
Sequence
MDDDTATEILDATYRALCQHGYAALTVKDIAAEADRSKASIHYYYDSKENLFTEFLDFLY
ERYTAKITGVDGSTPREELDSLLDTVLTDGRQTPGQEFRTAILEIKAQAPYNDAFRTQLA
RFDAVLFDRLREIIAAGVETGEFDSRVEPAVAAEFLVTAITGAHTRHVATDRSIDRFKET
ITRYAETHLLTDTPAEATR
Download sequence
Identical sequences A0A0B5GZN6 G0I0F9 V5TUH9
gi|344210188|ref|YP_004786364.1| WP_014031231.1.27393 WP_014031231.1.67629 WP_014031231.1.92404 WP_014031231.1.92869 gi|344210188|ref|YP_004786364.1|NC_015944 gi|564288181|ref|YP_008874394.1|NC_023012 gi|564288181|ref|YP_008874394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]