SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288373|ref|YP_008874573.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288373|ref|YP_008874573.1|
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.08e-59
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 331-492,742-808
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.23e-42
Family Intein (protein splicing domain) 0.015
Further Details:      
 
Domain Number 3 Region: 285-354,811-1097
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-29
Family Extended AAA-ATPase domain 0.013
Further Details:      
 
Domain Number 4 Region: 569-671
Classification Level Classification E-value
Superfamily Homing endonucleases 2.09e-17
Family Intein endonuclease 0.011
Further Details:      
 
Domain Number 5 Region: 679-735
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000483
Family SinR domain-like 0.03
Further Details:      
 
Domain Number 6 Region: 480-552
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000227
Family Intein endonuclease 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564288373|ref|YP_008874573.1|
Sequence length 1175
Comment cell division protein [Haloarcula hispanica N601]
Sequence
MATAENTELIDRFEEFYRNYYRNEIGELAQKYPNDQKSLYIDWDDLYRFDPDLADDYRTK
PEQIQEYAEEALRLYDLPVDVSLGQAHVRVRNLPESEDIRDLRHEHHGNLVAVRGIIRKA
TDVRPKVIEAAFECQRCGTLTRIPQTAGDFQEPHDCQGCERQGPFRLNTDQSQFIDAQKL
RVQESPEGLRGGETPQSIDINIEDDITGHVTAGDHVRVTGILKLDQRGNDNEKSPMFDIY
MEGVSVEIEDEQFEDMEITDADKKEIVELSNEADIYDKMVGAIAPSIYGYEKEKLAMMLQ
LFSGVTKELPDGSRIRGDLHMLLIGDPGTGKCVHGDTRVTLADGHERPIREVVESNLDDP
KPVDDGVWDTVDFDVPSLQSDGTVATQNATKVWKRKAPETLYRIRTATGRELDVTPSHPL
FVQSNGRFQARKAEELESGTHVAVPRKVSTNARNELDVTFRQSQAHNRIDLDLPPQWTPE
LARLIGYIVAEGYVEQRPDNTGYVSITNNDREVLDDAKSVLETLNLNVTERSSHEGKTTR
ELLCSAGEFVSFLASLDETLLQSSAERRVPQDIMRASDNVVTGFIRGYIEGEGHVSTSQR
EITVASMSKPLLEDVRTLLVTQGITAQLQPRNNGSYRLRISGNSFHDYAEQIGFITARKT
EACRQFEGTHGNTNLDIVPNLGPELRRIREALGLTQSECGLPRSTYQHYERGRRNPSRDS
LESVLDAFQARLAEMNNDTPISDTARSDGGGTGSLRQDLDSLTAFVEGDMAWDRIESIEP
IEHDEKWVYDLEIEGTHNYLTNGVVSHNSQMLSYIENIAPRSVYTSGKGSSSAGLTAAAV
RDDFGDGQQWTLEAGALVLADQGIAAIDELDKMSPEDRSAMHEALEQQRISVSKAGINAT
LKSRCSLLGAANPKYGRFDQYEPIGEQIDLEPALISRFDLIFTVTDKPDEEKDRNLAEHI
IQTNYAGELHTHRTENPTSNFSEEEVGTVTEEVAPTIEPDLLRKYVAYAKRNCFPTMTEE
AKSRIEDFYVDLRMKGQDEDAPVPVTARKLEALVRLAEASARIRLSDTVDEADADRAVDI
AHYCLKEIGVDPETGEFDADVVETGQSKTQRDRIQNIKGIISDIEDEYDEGAPADVVIER
AEEVGIDESKAEHEIDKLKQKGEVYEPRTDHLRTT
Download sequence
Identical sequences A0A0B5GIT5 G0HQ84 V5TJ14
gi|344210351|ref|YP_004794671.1| WP_014039080.1.27393 WP_014039080.1.67629 WP_014039080.1.92404 WP_014039080.1.92869 gi|564288373|ref|YP_008874573.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]