SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288386|ref|YP_008874586.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288386|ref|YP_008874586.1|
Domain Number 1 Region: 74-189
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.7e-18
Family Tetracyclin repressor-like, C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily Homeodomain-like 6.67e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564288386|ref|YP_008874586.1|
Sequence length 198
Comment transcriptional regulator [Haloarcula hispanica N601]
Sequence
MNDGDTADDIMDATYRALCTHGYADLTMQDIADESDKSKAALHYHYDSKHDLLCAFLEYL
YDGFVDRIEDPDGENPHERLLALIDSVLDKPDDGSEEFGTAILEIRAHAPYEPGFRERLT
KFDDYLVDELEVILEDGITGGTFKSDLDAEETAQFIVTVLTGAATERVTTGRPVECTRRM
LAEYVETHLLDGQQEVTA
Download sequence
Identical sequences A0A0B5GU52 G0HQ97 V5THS7
WP_014039092.1.27393 WP_014039092.1.67629 WP_014039092.1.92404 WP_014039092.1.92869 gi|344210364|ref|YP_004794684.1| gi|564288386|ref|YP_008874586.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]