SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288435|ref|YP_008874637.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288435|ref|YP_008874637.1|
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.6e-63
Family Phosphate binding protein-like 0.0000421
Further Details:      
 
Domain Number 2 Region: 210-280
Classification Level Classification E-value
Superfamily GlnB-like 1.33e-20
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564288435|ref|YP_008874637.1|
Sequence length 282
Comment ATP phosphoribosyltransferase [Haloarcula hispanica N601]
Sequence
MRIAVPNKGRLHEPSEELLERAGLHLVDGADRQLHADTVDPDVTVLYARAADIPEYVADG
AADVGITGLDQVRESDTDDLVELRDLDFGRCRLVLAAPEDSDIETVYDFEGGRIATEFPK
ITRRYFDRVDVDVDVTEVSGATELTPHVDIADGIVDITSTGTTLRMNRLAVVDEVLESSV
RLFAREDTADDEKVQQVDTALGSVLAAEDKRYLMMNAPEDALDDVEDVLPGMGGPTVMDI
AGSDQLAVHAVVEERAVFETISSLKDVGASDILVTEIERLVE
Download sequence
Identical sequences A0A0B5GU84 A0A162FYR7 G0HQE8 V5TH43
gi|344210415|ref|YP_004794735.1| gi|564288435|ref|YP_008874637.1| WP_014039135.1.13069 WP_014039135.1.27393 WP_014039135.1.67629 WP_014039135.1.92404 WP_014039135.1.92869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]