SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|564288575|ref|YP_008874783.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|564288575|ref|YP_008874783.1|
Domain Number - Region: 113-178
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000907
Family Group I mobile intron endonuclease 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564288575|ref|YP_008874783.1|
Sequence length 219
Comment cobalamin operon protein [Haloarcula hispanica N601]
Sequence
MSVETGAPNDMLAAHPETAYFWGRVTGDGECEDGCITVRTNDETAARRLASIAGAERADR
RIVERAYAHDTSITRQEEEFTVQVVGSLADRASAALGLPFDGESGGYRFDALADYDRQLL
RGLLEGCGTVCFKSDDEAVGISFVHEDERLLRTIQTLLDRCPVDAPYDELSETSSGYWFG
VADDAAPVLGDWLYEGSEETGLFAPSRRRKLQKSIERVR
Download sequence
Identical sequences G0HRQ9 Q5UYB7 V5THG5
gi|344210560|ref|YP_004794880.1| WP_011224564.1.67629 WP_011224564.1.69175 WP_011224564.1.92404 gi|564288575|ref|YP_008874783.1| gi|55379592|ref|YP_137442.1| 272569.rrnAC3010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]