SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|564288623|ref|YP_008874834.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288623|ref|YP_008874834.1|
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000284
Family CodY HTH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|564288623|ref|YP_008874834.1|
Sequence length 270
Comment TrmB family transcriptional regulator [Haloarcula hispanica N601]
Sequence
MYRPLDHPTMTELAELGLSNYEETAYRTLLVTGAVSASDLSDASGVPRGRIYDVLNGLEA
RGIVRTQSTDPTRYTPVDPETVVDRLLSERTRELASEFDRYRSVAASVRADLLPAPPVDS
SFWLGSLGSEEMRAAMSRHVRTAREHVRATVGPPYERASWETLQTEVDAFLDGVGEDVRV
DLLCSEAVLDVLPESLPDLLADRNAAVRAVPTVGVSFDVIDAAAVTVDVPDPLSPADRLG
VVGITDSEVAAAFEARFERLWVEAEPLLGR
Download sequence
Identical sequences G0HSB7 V5TJT2
WP_014039316.1.13069 WP_014039316.1.67629 WP_014039316.1.92404 gi|344210611|ref|YP_004794931.1| gi|564288623|ref|YP_008874834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]